PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00012.254
Common NameAMTR_s00012p00251530, LOC18436206
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family G2-like
Protein Properties Length: 288aa    MW: 32056.2 Da    PI: 6.6162
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00012.254genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like95.44.2e-30135188155
                                   G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                               +prl+Wtp+LH+rFv++v++L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  evm_27.model.AmTr_v1.0_scaffold00012.254 135 RPRLVWTPQLHKRFVDVVAHL-GIKNAVPKTIMQLMNVEGLTRENVASHLQKYRL 188
                                               59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.27E-19132192IPR009057Homeodomain-like
PROSITE profilePS5129410.061132191IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.8E-30134193IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-23136188IPR006447Myb domain, plants
PfamPF002494.7E-8138187IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MGEEEQSIDY QPSSEEDHVM EWELGLPRAE DLTPLSQVLI PPELASAFSI SPEACRSMLD  60
VNRASQNTVS TLRRQALPTN LKSLPSFSLQ QEHEPTEPAT ESRARKFSDR EATDEIMDSS  120
RPDPVDEQSA RTLKRPRLVW TPQLHKRFVD VVAHLGIKNA VPKTIMQLMN VEGLTRENVA  180
SHLQKYRLYL KRMQGLSSEG PSSSDHLFAS TPVPHSLARE EPQGLMPIPM PYMIPMPMAG  240
HHAHGHMGHG HGHMAMTNGN MGYHGYGAFG PQNKFDSIVG YPHVSKQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-19134193463ARR10-B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00014PBMTransfer from AT3G46640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006846291.10.0PREDICTED: transcription factor PCL1
SwissprotQ9SNB47e-86PCL1_ARATH; Transcription factor LUX
TrEMBLW1PJX60.0W1PJX6_AMBTC; Uncharacterized protein
STRINGVIT_06s0004g05120.t011e-100(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP11571753
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46640.26e-82G2-like family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]